PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo15G0027200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 285aa    MW: 32875.3 Da    PI: 7.1296
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo15G0027200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.2e-161057148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd ll ++v q+G g+W++I+++ g++R++k+c++rw++yl
  Spipo15G0027200 10 KGAWAPEEDILLQRCVLQYGEGQWHLIPERAGLKRCRKSCRLRWLNYL 57
                     799*******************************************97 PP

2Myb_DNA-binding45.32.1e-1463107147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++ ++E +l+++++++lG++ W++Ia +++ gRt++++k++w++ 
  Spipo15G0027200  63 RGAFQEDEVDLIIRLHRLLGNR-WSLIAGRIP-GRTANDIKNYWNSC 107
                      899*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.33157IPR017930Myb domain
SuperFamilySSF466893.29E-267104IPR009057Homeodomain-like
SMARTSM007176.1E-13959IPR001005SANT/Myb domain
PfamPF002497.8E-151057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-211164IPR009057Homeodomain-like
CDDcd001671.08E-81257No hitNo description
PROSITE profilePS5129423.13458112IPR017930Myb domain
SMARTSM007177.2E-1162110IPR001005SANT/Myb domain
PfamPF002491.8E-1363107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2265112IPR009057Homeodomain-like
CDDcd001672.17E-868105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MESQVVSVRK GAWAPEEDIL LQRCVLQYGE GQWHLIPERA GLKRCRKSCR LRWLNYLKPS  60
IKRGAFQEDE VDLIIRLHRL LGNRWSLIAG RIPGRTANDI KNYWNSCLCR KLGARGEVAG  120
KINKRNTADL AAIKSKAIDL PQKHYPLGRS RPPHLPSHFT EAISGSCHEI LRPRPRTLSE  180
GTIRLPDIIA CREFLPGGQC FPPKDDRRVT EQDSMAWTRL LLEEDENDEG QRRQEEREER  240
EAIPFPEEEE ILHWTPQTDG EVERGWWLLG WEDVFWDTDL TSGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-23101127108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007033038.13e-56R2R3 MYB transcription factor splice variant 1
SwissprotQ9FNV92e-53MY113_ARATH; Transcription factor MYB113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.13e-54myb domain protein 113